General Information

  • ID:  hor003021
  • Uniprot ID:  P55207
  • Protein name:  CNP-53
  • Gene name:  Nppc
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Natriuretic peptide family
  • Source:  animal
  • Expression:  Expressed exclusively in brain.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0051427 hormone receptor binding
  • GO BP:  GO:0001503 ossification; GO:0001525 angiogenesis; GO:0001541 ovarian follicle development; GO:0001549 cumulus cell differentiation; GO:0001666 response to hypoxia; GO:0001974 blood vessel remodeling; GO:0002931 response to ischemia; GO:0003418 growth plate cartilage chondrocyte differentiation; GO:0003419 growth plate cartilage chondrocyte proliferation; GO:0006182 cGMP biosynthetic process; GO:0006457 protein folding; GO:0006874 intracellular calcium ion homeostasis; GO:0006950 response to stress; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0008285 negative regulation of cell population proliferation; GO:0009410 response to xenobiotic stimulus; GO:0009611 response to wounding; GO:0009791 post-embryonic development; GO:0010753 positive regulation of cGMP-mediated signaling; GO:0019934 cGMP-mediated signaling; GO:0022414 reproductive process; GO:0032966 negative regulation of collagen biosynthetic process; GO:0035483 gastric emptying; GO:0036293 response to decreased oxygen levels; GO:0040014 regulation of multicellular organism growth; GO:0043524 negative regulation of neuron apoptotic process; GO:0045471 response to ethanol; GO:0045669 positive regulation of osteoblast differentiation; GO:0048513 animal organ development; GO:0048599 oocyte development; GO:0048660 regulation of smooth muscle cell proliferation; GO:0048678 response to axon injury; GO:0051276 chromosome organization; GO:0051321 meiotic cell cycle; GO:0051447 negative regulation of meiotic cell cycle; GO:0061939 c-di-GMP signaling; GO:0071965 multicellular organismal locomotion; GO:0090649 response to oxygen-glucose deprivation; GO:0097746 blood vessel diameter maintenance; GO:1900194 negative regulation of oocyte maturation; GO:1903537 meiotic cell cycle process involved in oocyte maturation; GO:1904588 cellular response to glycoprotein; GO:2000279 negative re
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030141 secretory granule; GO:0032991 protein-containing complex

Sequence Information

  • Sequence:  DLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGSMSGLGC
  • Length:  53
  • Propeptide:  MHLSQLIACALLLALLSLRPSEAKPGTPPKVPRTPPGEELAEPQAAGGNQKKGDKTPGGGGANLKGDRSRLLRDLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGSMSGLGC
  • Signal peptide:  MHLSQLIACALLLALLSLRPSEA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  plays a role in endochondral ossification through regulation of cartilaginous growth plate chondrocytes proliferation and differentiation. May also be vasoactive and natriuretic.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Npr2, Npr3
  • Target Unid:  P16067, P41740
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  37-53
  • Structure ID:  AF-Q058G9-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-Q058G9-F1.pdbhor003021_AF2.pdbhor003021_ESM.pdb

Physical Information

Mass: 672647 Formula: C251H416N82O70S3
Absent amino acids: Q Common amino acids: GKL
pI: 10.93 Basic residues: 14
Polar residues: 18 Hydrophobic residues: 15
Hydrophobicity: -67.74 Boman Index: -11695
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 71.89
Instability Index: 1065.85 Extinction Coefficient cystines: 7115
Absorbance 280nm: 136.83

Literature

  • PubMed ID:  NA
  • Title:  NA